McDonnell Genome Institute

Washington University

CircRNA

chr8|38234393|38253718|+|DDHD2|ENST00000397166.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9264

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

AIYATGK

Amino Acids from 5' Exons

EKVVMGELFLLMGADMMFIWGRGCGMLYTGMNWHRKDDVRGFTRGTKTISMFPTRRASAKF,KRLWESCSYWGQICSFGGEDAVCCILGTGIGSETMYVVLQGGQRQVCSLLGELQPSFR,KGCNGRVVPTDGGRYDVHLGERMRYAVYWDELASEVRRCTWFYKGDKDNKYVPYSESFSQVLE

Amino Acids from 3' Exons

MLTQKRPLWQLKKKSCLSMWGCMEANALTMCYRRSLLKVLMSIYLLYKAIYAT,CHRRDLCGSRRSPAYQCGDAEWRPTHLCATGEAYKFVFICFTKPSMLL,VNTEETSVAVKEEVLPINVGMLNGGQRIDYVLQEKPIESFNEYLFALQSHLCY