McDonnell Genome Institute

Washington University

CircRNA

chr8|37874514|37875322|-|RAB11FIP1|ENST00000287263.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9512

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LSQSPSLNR

Amino Acids from 5' Exons

SCLTREQRVRILSNTRSTLPFPRRKDFPFLVAFGLRMMSFPALMSASMGTMFTWSSQKPRVRSRIAARPPPHPPRASERSICSLLQRTWRLGLGRSLLKEVGCLLTGSSPNLPPRTPSLPCRPTDLPHWSVGTSGKTWPPQTQRPQKKLRRARSQRAGGPLCCLRGRRMWLRAVKVKTLSRSQGGRRKACWGLSRGRTHRGLLKTLEDLRKILQLLSPDRAAPTSLKMCRSQNQKLSQSPSLNRDLQFPLRGLPRPELSSP,HVSQENSEYGSATEPGQLYPSQEGRTFLSWWPSVECPFPLCLHQWEPCLPGAARSQGDQGQPVLLPIPQGLQKEAFVLFYREPGGWVLEGACRRWAVFQAALRIFHQGLLEVYDPAVLPTCPTGQWGPQGKHGPRKLRGHKRSGEQEAREQEVLFAVSDDGEEGCGGQRKPSHGPREGEGRHADGGAGGGRIGACRPCEKIERYCSCCLQTGQLPEPLRCADHRTRSARVQVTETSNFLSEGSPDQSCQAP,MSHKRTASTDLKQLNQVNFTLPKKEGLSFLGGLRSKNDVLSRSNVCINGNHVYLEQPEAKGEIKDSSPSSSPSPKGFRKKHLFSSTENLAAGSWKEPAEGGGLSSDRQLSESSTKDSLKSMTLPSYRPAPLVSGDLRENMAPANSEATKEAKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDVQITEPEAEPESKSEPRPPISSPRAPQTRAVKP

Amino Acids from 3' Exons

SCLTREQRVRILSNTRSTLPFPRRKDFPFLVAFGLRMMSFPALMSASMGTMFTWSSQKPRVRSRIAARPPPHPPRASERSICSLLQRTWRLGLGRSLLKEVGCLLTGSSPNLPPRTPSLPCRPTDLPHWSVGTSGKTWPPQTQRPQKKLRRARSQRAGGPLCCLRGRRMWLRAVKVKTLSRSQGGRRKACWGLSRGRTHRGLLKTLEDLRKILQLLSPDRAAPTSLKMCRSQNQKLSQSPSLNRDLQFPLRGLPRPELSSP,HVSQENSEYGSATEPGQLYPSQEGRTFLSWWPSVECPFPLCLHQWEPCLPGAARSQGDQGQPVLLPIPQGLQKEAFVLFYREPGGWVLEGACRRWAVFQAALRIFHQGLLEVYDPAVLPTCPTGQWGPQGKHGPRKLRGHKRSGEQEAREQEVLFAVSDDGEEGCGGQRKPSHGPREGEGRHADGGAGGGRIGACRPCEKIERYCSCCLQTGQLPEPLRCADHRTRSARVQVTETSNFLSEGSPDQSCQAP,MSHKRTASTDLKQLNQVNFTLPKKEGLSFLGGLRSKNDVLSRSNVCINGNHVYLEQPEAKGEIKDSSPSSSPSPKGFRKKHLFSSTENLAAGSWKEPAEGGGLSSDRQLSESSTKDSLKSMTLPSYRPAPLVSGDLRENMAPANSEATKEAKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDVQITEPEAEPESKSEPRPPISSPRAPQTRAVKP