McDonnell Genome Institute

Washington University

CircRNA

chr8|30689160|30709902|-|GSR|ENST00000221130.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

26

Peptide

LVMWNTAVHSEFMHDHADYGFPSCEGK

Amino Acids from 5' Exons

VKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKL,SRRLKRLCRAWKSAWLLQFPVGYQSPFQMLTACSGPLGGSRIPRTVTN,QGGKDFVGLGSQHGYCSSRATSHDHDSRCLPALGHWAGPEYQGPEFKQT

Amino Acids from 3' Exons

VMWNTAVHSEFMHDHADYGFPSCEGKFNW,CGTQLSTLNSCMIMLIMAFQVVRVNSIG,NVEHSCPLIHASCLWLSKLGIQLA