McDonnell Genome Institute

Washington University

CircRNA

chr8|30689160|30696479|-|GSR|ENST00000221130.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.953

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

DPVSPGF

Amino Acids from 5' Exons

VKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKL,SRRLKRLCRAWKSAWLLQFPVGYQSPFQMLTACSGPLGGSRIPRTVTN,QGGKDFVGLGSQHGYCSSRATSHDHDSRCLPALGHWAGPEYQGPEFKQT

Amino Acids from 3' Exons

PQRHCWCRLHCCGDGRDPVSPGFDITDDTA,RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDK,AASLLVQVTLLWRWQGSCQPWVLRHHYGMI