McDonnell Genome Institute

Washington University

CircRNA

chr8|3018476|3052647|-|CSMD1|ENST00000335551.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9098

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

4

Peptide

LWGLMSESAWQMGSGAAAK

Amino Acids from 5' Exons

LSRVEAFPFPQMATRLERQFMGPQLYLRATPATRLWGLMSESAWQMGSGAAAKLDVW,YLVWKPFLSPKWQQDWNVDSLWGHSYIYVQHRLHACGVSCQRVLGKWALERQRNSMS,ISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCL

Amino Acids from 3' Exons

LCPVESQNPQETVHLPGTSSLWTVKWSMNVMRASSLNPASKQQPCVKKMGCGVTRGSRPRVS,CVLWNPRIPRKRFIYRERVHFGQSGLMSGLQAIQPASNSRVSRRWVVEQGEAAHV,VSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCK