McDonnell Genome Institute

Washington University

CircRNA

chr8|29338281|29340243|-|DUSP4|ENST00000240100.6

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9121

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

4

Peptide

ADISSWFMEAIEYIGGYER

Amino Acids from 5' Exons

GGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYI,GVLWRSFPSSTSAVPTMLPGETCWTPWASRLCMSPRTAQTTLKDTISTSASQWKITTRPTSAPGSWKPSTS,GSCGDPSLPLPRQCLPCCPERHAGRPGHHGSVECLLGLPKPLRTLSVQVHPSGRPQGRHQLLVHGSHRVH

Amino Acids from 3' Exons

AAMRGFPPSTQNSVLKPRPWQPSHPRFPPVPQSPWTWAAAPVGPHYTT,RLEVFLRVPRILFNQGPGSHPTPGSPQCHRALGPGLQLLWDPTTRP,GYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQ