McDonnell Genome Institute

Washington University

CircRNA

chr8|29186291|29191057|-|KIF13B|ENST00000521515.1

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9253

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

16

Peptide

GCLLMIIVSGLWMNLSK

Amino Acids from 5' Exons

ALENLIPWAQLTNLDSQDFAVDSLNELRKRKMKNRVLKKCPTWKFIMKKFETFLIPK,LWKILYHDGHSPTWINPKTLQWTLTNSERGKRTEFSRSVLHGNLKSSRPSSQR,SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPK

Amino Acids from 3' Exons

VFAYDHCFWSMDESVKEKYA,CLLMIIVSGLWMNLSKKSMQ,VCLSLFLVYGICQRKVC