McDonnell Genome Institute

Washington University

CircRNA

chr8|29165661|29167585|-|KIF13B|ENST00000521515.1

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9895

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

TEEIAQDSLGGNSK

Amino Acids from 5' Exons

AMKSPELKDRLEESEKLIQEMTVTWEEKLRKTEEIAQ,QNLQSRTGWKNLRSSRKLPGRRNGKRRRLH,NEISRAKGPAGRIEANPGNDCDLGGEIKENGGDCT

Amino Acids from 3' Exons

DSLGGNSKTAMVATVSPAADNYDETLSTLRYADRAKHIVNHAVVNEDPNARIIRDLREEVEKLREQLTKAE,TASGVTARPPWWLLVLQLITMMKPSQLCGMQIEPSTLTTLWMRTLMPELSGISGKKLRNSGSSPKQ,QPRGQQDRHGGYCESCSLNPLNSAVCRSSQAHCKPRCGEGPCPNYPGSPGRSETPGAADQSR