McDonnell Genome Institute

Washington University

CircRNA

chr8|29148576|29182006|-|KIF13B|ENST00000521515.1

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9295

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

ALGSNEAVR

Amino Acids from 5' Exons

TQFAKEKESRTRGGPGSLHEEREFAAGCRRRLLQRGVQSLLRIRTDGGHHEGPGQQ,LNLPKKKKKAEREDEDQDPSMKNENSSEQLDVDGDSSSEVSSEVNFNYEYAQMEVTMKALGSN,SICLKRKRKQNERMRTRIPPRTRIVLSSWMTETPPARCPVKLTLITNTHRWRSPRPWAAM

Amino Acids from 3' Exons

KPSDVESQRACVGTLCRRTFTGCHKLQ,SRQTLKVREHSVLGPYVDGLSKLAVTSYK,AVRRKSESIVCWDLMSTDFLNWLSQAT