McDonnell Genome Institute

Washington University

CircRNA

chr8|29148576|29177578|-|KIF13B|ENST00000521515.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9515

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

ALGSNDIWR

Amino Acids from 5' Exons

TQFAKEKESRTRGGPGSLHEEREFAAGCRRRLLQRGVQSLLRIRTDGGHHEGPGQQ,LNLPKKKKKAEREDEDQDPSMKNENSSEQLDVDGDSSSEVSSEVNFNYEYAQMEVTMKALGSN,SICLKRKRKQNERMRTRIPPRTRIVLSSWMTETPPARCPVKLTLITNTHRWRSPRPWAAM

Amino Acids from 3' Exons

TSGEKVGKLSLVDLAGSERATKTGAAGDRLKEGSNIN,HLERKWANSAWWILAVNEQRRQALQGTGRKGATLT,IWRESGQTQPGGFSWQTSNEDRRCRGQAEGREQHQ