top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|25460383|25503544|+|CDCA2|ENST00000330560.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9825

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

LGSGNASFILGTGK

Amino Acids from 5' Exons

EMPLSFWELGRLLLRSMPNYLLILAHQILLNHLTFPQPSNWELHLKALLGTLQ,KCLFHFGNWEDCDSSEACRITSSLHTRYFITFELFHSNRRAIGNYTKLCELC,NASFILGTGKIVTPQKHAELPPNPCTPDTFKSPLNFSTVTVEQLGITPESFVRNSA

Amino Acids from 3' Exons

VLKSCRKKKGKGKKSVQKSLYGERDIASKKPLLSPIPELPEVPEMTPSIPSIRRLGS,FKVAERRKERERKVFRNLYMGKETLLLRSPSSVLFPSCLKSLRHLPFRASEDWVQ,FKKLQKEERKGKEKCSEIFIWGKRHCFEAPPQSYSRAASPDDTFHSEHPKTGF

bottom of page