McDonnell Genome Institute

Washington University

CircRNA

chr8|25302324|25317131|+|DOCK5|ENST00000276440.11

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.984

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

LLEDLSSMDLIRPR

Amino Acids from 5' Exons

DLSSMDLIRPRVSLVCQIVRVGHMELKEGKKHTCGLRRPFGVA,TLAAWTSSGPASALCARLSAWAIWSRKARSTPVDSEDLLEWQ,PQHGPHPAPRQPCVPDCPRGPYGAEGRQEAHLWTPKTFWSG

Amino Acids from 3' Exons

EMFGMTFMSPSTVSLTKGRRRRQRMWRRCLCTMRRASSW,RCSEHLCHPDPRVQREEEDAKECGGDDVCARGGQALG,DVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVHDEEGKLLE