McDonnell Genome Institute

Washington University

CircRNA

chr8|20211176|20217324|+|ATP6V1B2|ENST00000523482.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

54

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

32

Peptide

NGSITQIPILTMPNDGKFWYLDYNTPNHFKER

Amino Acids from 5' Exons

VSQSTLNVESTQRKFRLAFRPSMGTVLLGGRKFLSSLLLGYHTM,SANQPSMSNLPRGNDSDWHFGHRWDEQYCGAENSYLLCCWATTQ,QPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNE

Amino Acids from 3' Exons

HANYHSSPGSNHSISGVPMETCIGYSNRHEFLCSTSRGKLFMFFPQLNKIGFSGLTCHFASFHSLWFFNSTVHILIECLNKSERKLLRFCQLGRSDRLRFKWLACLSYCHYLHGLRNDCKREIIQAVYSVTLSGSSVSVQTINFTFLFHFCYFIKTLLSQYSLQHFFLQKTQCLFRKNIKILAGWARLIPVIPALWEAKAGGSLGIRSSRPAWVTQDPFSTKKLRYWLGVVAHTLVILVAQEAEVGGLESSNLRLRWAMIVPLPSSLGDRSRPASRKIITVTPRSFGVFVQYKLLKFVSYFFKHIKRFRDRLLKIPSVPSPYLTLLYCCFRLTLVKDFFSPIHHRPILLNAIKLSYKSEILTIYIIYKCRFNCIQQANYSAKLPKFLNAYLAFCVIIACQLVCRPCCEEHRCSTLLRCQSSTKLDFIMLGSSLVNMHTYSLVSMSLRERSFITILILCSAMDSLCDLQKLFNFSDPFQLLIGGSTFLIGLLGLSIMLSAADDSSCTFPSLLTFLGLGINMASSTTWNKSCEPRIFSVLKLTSFDLNCKQIFFQTIKLTLWQYDFSKNLLVPHCQHFCYRILIYVAGRFFIILKDSINEHDGIFNFVLWHVETNMLASLLYRAYSSAPAVRFQQPGKRYLVDEVFQVTCIQIPRYMNALGEWKGETARLLKSLFPCLMMVSFGIWIITHLIILKREKTHLPFRVEVILRTHPLRVYLGYLPKNIFHLKITHSYYPIVEEKQFSSFKFLTLLGTIECLLFAGHCSKCKEFLKRIYGLYLMVTQSNWGCFLCVCTGNLTWPCSVPHEEYKWETPQNETDFFNQGLVKNDFPMPVCVCAQDGVRLFRIPLLCCLFVLISVFEQHFDKIWVITYCNALFVLYKYSLICSSQLGRCCLRHREVKFVEISKIDPVVHNSHCYSVLPLTKFVPRELQNDVIQIWKCVALCDLFGAACVVLFTCLYACVLHGEMLCIHPTLMNECSYTSGWQISIRELWVNETLLILRGESAYLGERVFLMNAASLPHRANTCLTAATKLNWPVWLPLATFGCLSSSLKLKLSFSVLLATFQVLDSHIWLMATVLHSTDTEHWQHHRKLEHSSKCYRYRGTFCGFGSERWPLNSPKDAMLNANCLPLVDITHPIPDLTGYITEGQIYVDRQLHNRQVLDGSSAGKLADLLIRYSLVTWILLLGIALLRKYQLELFLIWLNCHFYYLKFWCRQSARIKNLLNTFLYCVLKQSHLSPRTFLGILFHNGIIYQSCYKKMTFPCLSSRCLLKSAFRNYCFFLFCVFFESVQKTILTRCGSTYQTDVESVFNSLVQCYRHFFGFDSRKKCYAIKCFLLPFLARKRQDSSRRQMQRLSLIVVIMSFKCFFITSKTVLYLNIVFFPSHSTQDLSTYQCAALTITVNEVCYWRRDDQEGSCRCIPA,IERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSCSCFSLSTKLVNFQGLVTLQVFILYGFLIPLFIYNALINQKGNYFVFVNLVEVIRGDLNGPVYHTVTISMDEMIVKGSKFKLFIQLLSREVLFLSRLLIFKPFCNSIFNDVNILRPYSHSTLFSTFFFRKPSVYLGKILRFQAGHGSSFLSQHFGKPRQEGHLGSGVQDQPGHSKTLSPQKNDIGWAWHTHLSLLRRLRWEDSLSPVIGCGGLLCHCPPVWVTDRDLLLKERLQLPLEVLGYLFSNTNYNFEVTFLSTKDSEETGFLKFLQCPHHILLCYIAVSDLSRTSFSPPSITDQYFCKMQNVIRKVKFLYIFTNADFRIVRFNRHKIILPNCPESFMLILLSVSLHVDNSWSADRAVRSTAVARSFEDVRVALRSWISCFRVLVDCRTCTPIVWYPCLGKDRLSPFLFCAVQWTPDFVTFRNCLIFLTLDSNCLEVAPSSGCCEDVKCCKAQQMIPRVHFLPFPFWDVRIWLVPPRGINLVNQESFLFNLPLIYKIANRFSSSKLFENLHYGNTILAKTFWCPIVNIFVTEYFEFMLPGDFSKSFLRTVFKMNMMGFSTLYFGMLKQTCCKQACCNIVHDTLLLDLLSGFSSQGRGTWSTRFSRLHVYRFSHDITRWASGREKRLDYSNPYSNHAWVLVFGLHTSFRERRPIYLFELKLFEHIPEFILVICLNKTFFIKLPTVIILLWRKSNFLHNLSFLYVLLSACCLQDTVLNVKNFKEFMVSTCKLLSLIGDVFYVCAPVIHGHVQCHMRSTSGKLHKTERQIFLTKGWLKMTFQCLSVCVPRMGYDYSEFLSCVASLSLFQFLNNTLTKYGKLLLTVIEHCSECFINIHSFAPHSNFEADAVGTGRSNDLLRLASDRFRTQFEFITHTVTLYCLRENDLFQGSSYKMMFNRFGNVLLCVTFLVQPVCCLLVYMPAFCMVKCCVSIRHSLTKNVLSIHQVGKFLGNFGFKMKLYLYEGRALTGREYFMQPVYLIEPTHVLLQPNTGQYGCRPHLAVVQVNNNNVFQFCPRFKCIATFGWLPYCTAQTQNIGSITENDSKNTLLSNVTGSTEGLFVGLVLRDGRFKTHNLKMPCLMPTVFLWISLTPSQTLATLQRGRSMWTDSCTTDRYWTGAVLGSLQTCSSVILLGFCSELLCLESINLNCFYGYKIVISIILNSGVGRAPELRIFLTLSFIVSNRVTCLQELFWEFCSIMVSSTNLVIDRKKLFHASLVDADFNQLLGIIVNFFYFVYNFLSQFRRPFLDNVVVLIKQMLKVEFFKIVLYSVIDDTFLDLILERNAMLSVSYYLFLPGRDSRIHLGDKCSGCLFKLVSNVFLLPVKLEFCTIYFFPLILPKIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQL,LSELSLLAWLPQLNFWRTNVRNMYWLFQTVLMLKHFERVVHVFPSVKQNWLIFRVNLSLCKFSFFMVFFHCSYINRMPIRKETTSFLSTWKLEVKIMVSLFIILSLSPWIKKLKGVNNSSCLFSYSLGKFCFCPDYFLNLFVIPFLMMLIFYKDPTLTVLSSALFSSENPVFIEKYDSSRLGTVAHSCNPSTLGSQGRRVTWDQEFKTSLGNIARPFLHKKIKILAGRSGTHTCNPSCSGGGGRIAVQFEAAVGYDCATALQSGQIETCFLKKDYNSYPKFWGICSVIQITEILSKLLFAHKKILKRQASNSFSALTISYSAILLFQTNSSQGLVFLPHPSQTNTFVKCNKIELLEKNFNYIYNLQMQILELLDSTGIKLFCQIALKVSKCLSCFLCDHCMLITVGLQTVLGAPLHAPLKMSEHLEVGFHNALGFLIVGEHAHLSGIHVSKGKIVYHHSYFVQCNGLLTLPSEIVFFPLIPTVNWRHLPHRVAVRIKLNNVVKRSRFLVYISFPFDLFGIRLDKYGFHHVEILTKNLFCFKINFLFIKLQTDFLLANYLKTYIMAIRFQKPSGAPLSTFLLQNTLNLCCREIFLNHSGQYLKTWDFQLCTLACNKHVVSKLVVISCMILFCLTCCQVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDGKFWYLDYNTPNHFKEREDPSTFSSSYFENTSPKSLSWLFAIKHFSFENYPQLLSYCGGKAIFFIIVFNFIRYYVPAVCRTLFMRIFEKNLWSLLNVSYSVLGMFFMCVHRFNMAMFSATGVQVGNSTKLRDRFFPRAGKLSNACLCVCPGWGTTIQNSSPVLPLCPYFSFTTLQNMVSYYLLLSTVLSALIFTHLLLIATLRQMLFEAQGGQMICDQVIDLGPSLSSLTLLLCTASDVKMICSKGVATKCNLTDLEMCCFVPFWCSLCSVVYLSICLRFAWNVVYPSDIAYELRMFLVYIRLANFYKGTLGLKNFTYIERGERLPRGESIFNECSQFTSSQHMSNCCNQTKLASMVAASHIWLFKFKLTEIIEIKFFSFVSHVSSVRPHLANGYRTAQHRHRTLAASQKMTLRTLFVMLQVVQRDFLWVWFEMAALKLITRCHACQLSSSGRYHSPHPRLDWLHYRGADLCGQTAAQQTGTGREQCWEACRPAHPLFFSDLDFALRNCFAKVSTIVFNMVIKLSFLLSILVSAERQNESSHFPLLCLKTESLVSKNFFGNSVPWYHLPILLLIEKNDFSMPLMLTSKISFELLLIFFILCIIFVSSEDHFDSIMWYLSNRCKLSFLKSCTVLMTLFWIFSKEMLCYKVFLTTFSCQEETVGFIETNAAVVFDLSCNNEFQMFFYYQNLSFVLKYSIFSLSFYPRFIHLSMCCPHYHGSLLLEKGPGRIMPMYLTS