McDonnell Genome Institute

Washington University

CircRNA

chr8|18799297|18804898|-|PSD3|ENST00000517971.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9917

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

MANAGVK

Amino Acids from 5' Exons

MESIALPVQCFLIPIYM,WSPLPYLCNNASYRSTW,GVHCLTCAIMLLNTDLHG

Amino Acids from 3' Exons

QCWGENNTARSSFNGEHNFGKGDPRKSQWYQQQCGSSQKVGQTPLSAGQIQKIRCCKTPWQE,NAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGK,MLGKQHGKLILKWGALKFWKRRPQKISVMVPAAMWKQPKGWPNAFISWTDSKDQMLQNTLAR