McDonnell Genome Institute

Washington University

CircRNA

chr8|16120417|16177992|-|MSR1|ENST00000262101.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9384

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

12

Peptide

AAHFGQEVWSSGITFTINR

Amino Acids from 5' Exons

LHLRKFDWSVGAALTRGGWRYSTAASGVQFVTIAGKCALDRSSVGAWDTQVFKPCTRQLTLDK,SIYESSTGRWERPSRGEGGDTPQRPVGYNLRSLGSARWTGRLELGIPRCSSRAQGSSLWT,PFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQ

Amino Acids from 3' Exons

KYGAVGSLSQSTGGHLLRICEICSLNDSFASS,SMEQWDHFHNQQEDTDSCSESVKFDARSMTALLPP,VWSSGITFTINRRTLIAAPNLNLMLAQQLCFLR