McDonnell Genome Institute

Washington University

CircRNA

chr8|15623079|15662296|+|TUSC3|ENST00000382020.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9517

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

TGWAMVSLNLLAEK

Amino Acids from 5' Exons

NLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVC,IFLKKSSWNGVPDAQSSEMVINSENLRHHLETIPLLCSLLFSLSGSVLCA,SFSKSRAADGMEFQTLNLPNEWIPKIYKGTTSKLFHDCYVHCSSASAAVFCVQ

Amino Acids from 3' Exons

IRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSL,FGFSDHPTTLVPLLWPCCRLLEVCFIEGTTWSSSITRLVGPWCL,SGFQTTQLLWYHCFGPVSVACWRFALFEKEQLGVHLQDWLGHGVS