McDonnell Genome Institute

Washington University

CircRNA

chr8|1548625|1549683|+|DLGAP2|ENST00000421627.6

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9946

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

AQPAPPGPR

Amino Acids from 5' Exons

TRSTHGRPRSTSMRSATRPRPGARAFPEVGPSRRCVPGTRVVWRPRRTASTCTTGPTRGRPTCAPPTAAPGGATAARRAARCTRSACRWCWATTCPAAPSRGCTTARTTTRATTALWPTRAPRSTASRPTCWTSSRSSCRCTGTASTRCSTRGRPRPPSSAARAPGGSATWYTPCRSSSPSRTRWRAPPKATPTAPRRTAGRTTTTTPTTPSTARGARARSASRRASPGPAAAGGARTTTWTATAPIGRPACSTGTTWAPWPTATPTRCRAPSGTCPSRPPRATTTSSARPVRGWRRPTPSTSAAPGLRRSARPRRPTARARTWTSRCCTRTPSPPGRATTS,PAVLMVAHAALQGALLARAQEHEGPFRKSDPAAAVFRAHVWSGAPGGLRAPAPRARRAAALPAEPRRQLPRGAPPLLAAQLGALGVRDDAGGAGRPRVQQHLPADALQLALRHARRLRCGPRGRQDQPHPGQPAGPVREAAAAAPGRLPHAAVPEDVRGRRAAQREPRADPPPGTLRAEALHQVALAGGLLQKQRQRHQGGRPGGRPPPRPPRQAQQEEQEQGAQAGGQAPARHEQLVELGRQPGQRQHLSDAQRAQPAPPGPRGPLLPRRAAEPLRGPVPQDLQEQQRRQVLGLGVGADARRQVPEAQLLVYADGQPGQGGLPQELAEPGQAAAAPGRQARPEAVPLPP,PQYSWSPTQHFNEERYSPAPRSMKGLSGSRTQPPLCSGHTCGLAPPEDCEHLHHGPDARPPYLLSPADSCPGGRHRCSPRSSVHSECVMMPVVLGDHVSSSTFPRMHYSSHYDTRDDCAVAHAGAKINRIPANLLDQFEKQLPLHRDGFHTLQYQRTSAAAEQRSESPGRIRHLVHSVQKLFTKSHSLEGSSKSNANGTKADGRADDHHHAHHAKHSKRSKSKERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKCSACEGLALTPDAKYLKRSSWSTLTVSQAKEAYRKSSLNLDKPLLHQDAKPALRPCHYLQ

Amino Acids from 3' Exons

TRSTHGRPRSTSMRSATRPRPGARAFPEVGPSRRCVPGTRVVWRPRRTASTCTTGPTRGRPTCAPPTAAPGGATAARRAARCTRSACRWCWATTCPAAPSRGCTTARTTTRATTALWPTRAPRSTASRPTCWTSSRSSCRCTGTASTRCSTRGRPRPPSSAARAPGGSATWYTPCRSSSPSRTRWRAPPKATPTAPRRTAGRTTTTTPTTPSTARGARARSASRRASPGPAAAGGARTTTWTATAPIGRPACSTGTTWAPWPTATPTRCRAPSGTCPSRPPRATTTSSARPVRGWRRPTPSTSAAPGLRRSARPRRPTARARTWTSRCCTRTPSPPGRATTS,PAVLMVAHAALQGALLARAQEHEGPFRKSDPAAAVFRAHVWSGAPGGLRAPAPRARRAAALPAEPRRQLPRGAPPLLAAQLGALGVRDDAGGAGRPRVQQHLPADALQLALRHARRLRCGPRGRQDQPHPGQPAGPVREAAAAAPGRLPHAAVPEDVRGRRAAQREPRADPPPGTLRAEALHQVALAGGLLQKQRQRHQGGRPGGRPPPRPPRQAQQEEQEQGAQAGGQAPARHEQLVELGRQPGQRQHLSDAQRAQPAPPGPRGPLLPRRAAEPLRGPVPQDLQEQQRRQVLGLGVGADARRQVPEAQLLVYADGQPGQGGLPQELAEPGQAAAAPGRQARPEAVPLPP,PQYSWSPTQHFNEERYSPAPRSMKGLSGSRTQPPLCSGHTCGLAPPEDCEHLHHGPDARPPYLLSPADSCPGGRHRCSPRSSVHSECVMMPVVLGDHVSSSTFPRMHYSSHYDTRDDCAVAHAGAKINRIPANLLDQFEKQLPLHRDGFHTLQYQRTSAAAEQRSESPGRIRHLVHSVQKLFTKSHSLEGSSKSNANGTKADGRADDHHHAHHAKHSKRSKSKERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKCSACEGLALTPDAKYLKRSSWSTLTVSQAKEAYRKSSLNLDKPLLHQDAKPALRPCHYLQ