McDonnell Genome Institute

Washington University

CircRNA

chr8|144505245|144505489|+|GPT|ENST00000394955.2

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9408

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

11

Peptide

ALCVINPGNPTDGAEAAGGRR

Amino Acids from 5' Exons

TVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPT,RCSCWWPARATHARVCSSPSPSTHSTRPRWQSWAQCRWITTWTRSVPGRWTWPSFTVHWARRVTTAALVRSVSSTLATPP,GAEAAGGRRGPHTHGCAHPHPPVPTLLGHAGRAGRSAGGLLPGRGACLGAGRGRASPCTGPGAPLPPSCALCHQPWQPH

Amino Acids from 3' Exons

TVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPT,RCSCWWPARATHARVCSSPSPSTHSTRPRWQSWAQCRWITTWTRSVPGRWTWPSFTVHWARRVTTAALVRSVSSTLATPP,GAEAAGGRRGPHTHGCAHPHPPVPTLLGHAGRAGRSAGGLLPGRGACLGAGRGRASPCTGPGAPLPPSCALCHQPWQPH