McDonnell Genome Institute

Washington University

CircRNA

chr8|144424040|144424819|-|VPS28|ENST00000526204.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9495

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

27

Peptide

SGGVLASGESVGVGPPFSSHTAVWAAR

Amino Acids from 5' Exons

IQPDLRELMETMHRMSHLPPDFEGRQTVSQ,SSPTCESWRPCTAATSHPTLRAARRSAS,PARPARADGDHAPHEPPPTRLGPPDGQPV

Amino Acids from 3' Exons

LDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSVRPSPQGTWLGEPRLPAAAGHERRVLGLQSAALLAGQKGTPLTRNEGWAACGDAPRPPGLLSGGAQGAFWRGPGLGRECGCGPTLQFPHSCLGSQDLVHPGGLQGLGTEYSEEAQVTAVAEEGLGPVSRGASRTRGHASLMCTPAPSSSSRSWTSCVWRSAPWM,WTARWPWSGSRRTGPSPSRTTRATSTAASQTWSRCAPAPRARGESRGCLLQLGTSVGSWASRAEQHSDLLGRREPLLGMRGGQHAGTPPGHLDSCRGDEHRVRSGGVLASGESVGVGPPFSSHTAVWAARTSFTQEACRVWEQSTVRRPKQLWLRRGWGPAVGPPAPVDTRASCAHLPPALHHGHGQAASGDPRHG,GLPAGHGADQGGPAHHHQGRQGQPQPLHRRRGLGAPQPPGHVVRRAEAACCSWARAGPGPPELSSTLTCWAEGNPFNEGVGSMRGRPQATWTPVGGMSTGCVLAGSWPRERVWVWAHPSVPTQLSGQPGPRSPRRPAGFGNRVQGGPSDSCGGGVGAREPWGLPHPWTREPHVHTCPQLFITVMDKLRLEIRAMDE