McDonnell Genome Institute

Washington University

CircRNA

chr8|144052982|144053129|-|OPLAH|ENST00000618853.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9028

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

8

Peptide

VQISLSQANAELAVR

Amino Acids from 5' Exons

ANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQ,QTLSWPCETCCVPLEPPGRPGACPWRCPRKTTWTTVPPSASVCRSAV,KRAGRARHVACLWNLPAGPGPAPGGVLGRPHGRRFPHPPPCADQPES

Amino Acids from 3' Exons

ANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQ,QTLSWPCETCCVPLEPPGRPGACPWRCPRKTTWTTVPPSASVCRSAV,KRAGRARHVACLWNLPAGPGPAPGGVLGRPHGRRFPHPPPCADQPES