McDonnell Genome Institute

Washington University

CircRNA

chr8|143932129|143932561|-|PLEC|ENST00000322810.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9845

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

4

Peptide

EDHPARPTVENSSK

Amino Acids from 5' Exons

ALMRELELKEKKIKELQNAGDRLLREDHPARPTVE,RCGSWSRRRRSRSSKMLGTGCCGRTTRPGPRW,ADAGAGAEGEEDQGAPKCWGPAAAGGPPGPAHGG

Amino Acids from 3' Exons

NSSKARLRSLESLHSFVAAATKELMWLNEKEEEEVGFDWSDRNTNMTAKKESYS,TPPRPASGPWRACTALWQPPLRSCGMRRRRRRWASTGATATPTPPRRRAT,LLQGPPQVPGELAQLCGSRHGANVAEEGGGGGGLRLERPQHQHDRQEGELL