McDonnell Genome Institute

Washington University

CircRNA

chr8|143926783|143975375|-|PLEC|ENST00000436759.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

SGGGAGSNGSVLDPAER

Amino Acids from 5' Exons

YVDLRTHYSELTTLTSQYIKFISETLRRMEEEE,TWTCVRTTASPHRASTSSSSARLCGAWRRR,RGPAYALQRADHTDEPVHQVHQRDSAAHGGGG

Amino Acids from 3' Exons

EAMSGEDAEVRAVSEDVSNGSSGSPSPGDTLPWNLGKTQRSRRSGGGAGSNGSVLDPAERAVIRIA,RPCRVRTLRSGQSLKMSPMEAVARPALGTHCPGTLGKRSGAGAAGVALGATGVSWTQLSGRSFASQ,GHVGGRGPGSLRCLQWKQWLAQPWGHTALEPWENAAEPAQRGWRWEQRECPGPSAGGHSHR