McDonnell Genome Institute

Washington University

CircRNA

chr8|143536256|143539320|-|ZC3H3|ENST00000262577.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9197

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

18

Peptide

HQSLALPVPQGPSGALWK

Amino Acids from 5' Exons

PSWRQEKRHLTCRHRQEPPQPPAETGPQGEEQPCPEEDPQQGPGTGHHAPTMSPATEPGPPPHQG,LPGDKKSGTSPAATAKSHLSLRRRQALRGKSSPVLKKTPNKGLVQVTTHRLCRLPPSRAHLPTKE,FLETRKAAPHLPPPPRATSASGGDRPSGGRAALSRRPPTRAWYRSPRTDYVACHRAGPTSPPRK,PSWRQEKRHLTCRHRQEPPQPPAETGPQGEEQPCPEEDPQQGPGTGHHAPTMSPATEPGPPPHQG,LPGDKKSGTSPAATAKSHLSLRRRQALRGKSSPVLKKTPNKGLVQVTTHRLCRLPPSRAHLPTKE,FLETRKAAPHLPPPPRATSASGGDRPSGGRAALSRRPPTRAWYRSPRTDYVACHRAGPTSPPRK

Amino Acids from 3' Exons

VLMTTKPSTAMPRPLVPQQLLGGSHPLTTVAEPLVPATLVQAGGATLPTMGLRGARNTPSIGPRDPQTLLPTMLCGRCTGPGGASLLSRSSMSLRDRSSSVRVRTWSSKLNRHQSLALPVPQGPSGALWKNLRKPPGVTKGPGKVKVSPLGDSCSPRGQQEPGGPAVWKILFWSARRSLVSPGWSQWAVWATAPGSPAGQSVRVLPSRRASHPPLCPHALAWPWAGSWVLIPWPAVLHSSLGTGEMLATQISQFRLAQWGAPPDRPQDPGRPGRPRWLPVELTSSGKTTTNGWLPPRRVPGLLGGPSVPEWLQRMCARPLLAWQTRWRSRSSLTQSPSPGSQPRPPSQGLPPASTSGRPPAPLPPPLPPSVGSRRPAARTMPPSSPQSCLGPRRGTDQQDTVASPSLGRPRSRLTKRAAPRSSGDAAAQ,SDLQNPPRQCPGPWYPSSFWVAATHLPQWQSLCPLPSSKPEGLLFPPWAFVAQEILPRESAPGTLRPSCRPCCAAVARGPGGPASCPAAACPETGPAQSGSERGHQSTAIKVWLCQCLRGPAGLFGRIGNPLEPKAPGRRAPSGTAAALEANKSQGDLQCGRSSSGLPEGAWAQDGEVSGQCGRQPPGAPPDSQECDCRQGELPILRSAPTHWRGPGPEAGFSFRGQLCSTAPWGQESRCWPHRSASSVWLSGGPRQTGLRTQAGPGGLAGCDLSNQVPEKQLQMGGCLLEESPGCSEGPQSQSGCRECVQGLCWHGKQGGEAAAHSPRAQAQEASHVLQARVCPQQVQVEGLQPLCLLLFLLPLAVGGQQQGPCLPALPSPVVPVGGQTSSRTQWLEAPLWGDPALGLQSEEPHQDHPETQQHK,LIDDYKTLHGNAPAPGTPAASGWQPPTYHSGRAFSARYPRPSRRGYSSHHGPSWRKKYSLVNRPPGPSDPPADHAVRPLHGARGGQPPVPQQHVLERQVQLSQGQNVVIKVKPPSKSGSASASGAQRGSLEEFEETPWSDQRPREGEGEPPRGQLQPSRPTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSALPPRTGVALGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVGGPARPASGPRQAREASLVVTCRTNKFRKNNYKWVAASSKSPRVARRALSPRVAAENVCKASAGMANKVEKPQLIADPEPKPRKPATSSKPGSAPSKYKWKASSPSASSSSSFRWQSEASSKDHASQLSPVLSRSPSGDRPAVGHSGLKPLSGETPLSAYKVKSRTKIIRRRSST,VLMTTKPSTAMPRPLVPQQLLGGSHPLTTVAEPLVPATLVQAGGATLPTMGLRGARNTPSIGPRDPQTLLPTMLCGRCTGPGGASLLSRSSMSLRDRSSSVRVRTWSSKLNRHQSLALPVPQGPSGALWKNLRKPPGVTKGPGKVKVSPLGDSCSPRGQQEPGGPAVWKILFWSARRSLVSPGWSQWAVWATAPGSPAGQSVRVLPSRRASHPPLCPHALAWPWAGSWVLIPWPAVLHSSLGTGEMLATQISQFRLAQWGAPPDRPQDPGRPGRPRWLPVELTSSGKTTTNGWLPPRRVPGLLGGPSVPEWLQRMCARPLLAWQTRWRSRSSLTQSPSPGSQPRPPSQGLPPASTSGRPPAPLPPPLPPSVGSRRPAARTMPPSSPQSCLGPRRGTDQQDTVASPSLGRPRSRLTKRAAPRSSGDAAAQ,SDLQNPPRQCPGPWYPSSFWVAATHLPQWQSLCPLPSSKPEGLLFPPWAFVAQEILPRESAPGTLRPSCRPCCAAVARGPGGPASCPAAACPETGPAQSGSERGHQSTAIKVWLCQCLRGPAGLFGRIGNPLEPKAPGRRAPSGTAAALEANKSQGDLQCGRSSSGLPEGAWAQDGEVSGQCGRQPPGAPPDSQECDCRQGELPILRSAPTHWRGPGPEAGFSFRGQLCSTAPWGQESRCWPHRSASSVWLSGGPRQTGLRTQAGPGGLAGCDLSNQVPEKQLQMGGCLLEESPGCSEGPQSQSGCRECVQGLCWHGKQGGEAAAHSPRAQAQEASHVLQARVCPQQVQVEGLQPLCLLLFLLPLAVGGQQQGPCLPALPSPVVPVGGQTSSRTQWLEAPLWGDPALGLQSEEPHQDHPETQQHK,LIDDYKTLHGNAPAPGTPAASGWQPPTYHSGRAFSARYPRPSRRGYSSHHGPSWRKKYSLVNRPPGPSDPPADHAVRPLHGARGGQPPVPQQHVLERQVQLSQGQNVVIKVKPPSKSGSASASGAQRGSLEEFEETPWSDQRPREGEGEPPRGQLQPSRPTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSALPPRTGVALGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVGGPARPASGPRQAREASLVVTCRTNKFRKNNYKWVAASSKSPRVARRALSPRVAAENVCKASAGMANKVEKPQLIADPEPKPRKPATSSKPGSAPSKYKWKASSPSASSSSSFRWQSEASSKDHASQLSPVLSRSPSGDRPAVGHSGLKPLSGETPLSAYKVKSRTKIIRRRSST