McDonnell Genome Institute

Washington University

CircRNA

chr8|142343965|142344472|-|TSNARE1|ENST00000307180.4

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9753

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

ECAGLLSPRR

Amino Acids from 5' Exons

GLGLPLKAAGCRSPPHHPPLARGRTRLLGPMAGWRGPALPGPRRGSPTSARRRPRCWCPRASTTSCCLARGCRPSPLAGTACGAASCRPMRWATVAATLWTSTSGGTYEPSCGASWATSGRRPMAPALVPASPRPWLSRPWSRWWPRPSLARPCPPRASVWSRPE,AWGCPRQPDAGAHLITHHWPEEGLGCWAPWPDGGAQHYPGQEEEAQLLPAGDRGAGVQGEQAPPAAVWHGAAEGRAHSQVPRVEPHPAGRECAGLLSPRRCGPEAQVAGPTSRRAAQAGRPPEGGPWPQPWFRQAPGPGSHARGAGGGQDLLLPGPALRGLQSGAAQ,PGVAPEGSRMPEPTSSPTIGPRKDSAAGPHGRMAGPSTTRAKKRKPNFCPQETEVLVSKVSKHHQLLFGTGLLKAEPTRRYRVWSRILQAVNALGYCRRDVVDLKHKWRDLRAVVRRKLGDLRKAAHGPSPGSGKPQALALTPVEQVVAKTFSCQALPSEGFSLEPPR

Amino Acids from 3' Exons

GLGLPLKAAGCRSPPHHPPLARGRTRLLGPMAGWRGPALPGPRRGSPTSARRRPRCWCPRASTTSCCLARGCRPSPLAGTACGAASCRPMRWATVAATLWTSTSGGTYEPSCGASWATSGRRPMAPALVPASPRPWLSRPWSRWWPRPSLARPCPPRASVWSRPE,AWGCPRQPDAGAHLITHHWPEEGLGCWAPWPDGGAQHYPGQEEEAQLLPAGDRGAGVQGEQAPPAAVWHGAAEGRAHSQVPRVEPHPAGRECAGLLSPRRCGPEAQVAGPTSRRAAQAGRPPEGGPWPQPWFRQAPGPGSHARGAGGGQDLLLPGPALRGLQSGAAQ,PGVAPEGSRMPEPTSSPTIGPRKDSAAGPHGRMAGPSTTRAKKRKPNFCPQETEVLVSKVSKHHQLLFGTGLLKAEPTRRYRVWSRILQAVNALGYCRRDVVDLKHKWRDLRAVVRRKLGDLRKAAHGPSPGSGKPQALALTPVEQVVAKTFSCQALPSEGFSLEPPR