McDonnell Genome Institute

Washington University

CircRNA

chr8|141155848|141168525|+|DENND3|ENST00000262585.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9861

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

LFEALTVGSRR

Amino Acids from 5' Exons

EADGLVLINIDHGSITYSKSTDDNVDIPDVPLLAAQTFIQ,KPTVFILIMGASPTPSPRTITWTFLMSPSWQPRRLFR,SRRFSSDKYSWEHHLLQVHGRRGHSCPPPGSPDVYSE

Amino Acids from 3' Exons

FMSRRSPRIHSRFPKSTFRWRASACRHTMPTLSPCARPCAFWPPITLCSWPAICTSEGSFICRDSCTPSWTSRICIKQTYGSFPLIWRGRWNPCLPLSGRGLSRRRSGSSARSWTSRTRPRSWTTTRSSSCPRSTCSWATSSGSRSQGSRTPASYTGCSRPL,SECHAEVPVYIQDSRNPLSAGEQVRAGIPCPLCLHAERGHVLSGPRLSAPGPLFVPPRARLSDAGTAAERPLGLPESVNRHTDLSHFGEEDGGIHVCPVGGGAGAGADEAHQRDPGQAARGLEAGRPREEVQAAQEAHAAGRLHEAGPGVRDREGRQHHTPAVRGLDC,LNVTPKSPYTFKIPEIHFPLESKCVQAYHAHFVSMLSEAMCFLAPDNSLLLARYLYLRGLVYLMQGQLLNALLDFQNLYKTDIRIFPTDLVKRTVESMSAPEWEGAEQAPELMRLISEILDKPHEASKLDDHVKKFKLPKKHMQLGDFMKRVQESGIVKDASIIHRLFEALTV