McDonnell Genome Institute

Washington University

CircRNA

chr8|134600435|134602933|-|ZFAT|ENST00000377838.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

118

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

ASASWNLVGTSSK

Amino Acids from 5' Exons

ANFFGTKCILICMSAPTPGNICIIALSVIILPSPKTALNATFRNTVTSCSVPPMAVTTQLQINISYRHILKFTQH,QTFLVPSAFYACPHPHPGTSVLLLSVSLFFHHQKLPTPRNSETQHLAEVSHRWLLLNSRIATGTSSSHST,KLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTAL

Amino Acids from 3' Exons

ARSHSAQNLHLILQQGLQVQALAAGPPEDPHQKAIQVPPVQLCQCHQGQPQCAPAQAHWREVRLRLLLVHLPEQGPPQGAHRASAQEDQAALPLLQEEVLRQEPHQAHPRRAPTGQEGQRGLGRALPDDEGGQAAAALLPHLAQVQERAGPPPYAGPRRQVAFCLALWPWGHQVPGAGTACQEAPLRVRLCRLPQEVRQLHQAAHPHQRGARGCPGGLGLHQFHQPELLPPGTWWGHPARSSGGPATAGGRGVCPPGRECTQGRGLSWGHSAGGGPEGAGGPWGNACPSCAPGLPAGRKHSPATLAGNHRGLLLRPAFSRGGFRFFVEKYLLRRGSCCSEAPRHAAQKLSPDARSDHTTAVQGPECWVRSGKPWRPEPPRGRAEHGCAFSWPRSQQVSQVKPSGLRPPPSSSWWWGHHHTSALLQSCPAPVRHHRFHEGPEQFTEEANEHQLVADPEGLWRPGVIL,LGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCAVCRKKFVSSIRLRTHIKEVHGAAQEALVFTSSINQSFCLLEPGGDIQQEALGDQLQLVEEEFALQGVNALKEEACPGDTQLEEGRKEPEAPGEMPAPAVHLASPQAESTALPPCELETTVVSSSDLHSQEVVSDDFLLKNDTSSAEAHAAPEKPPDMQHRSSVQTQGEVITLLLSKAQSAGSDQESHGAQSPLGEGQNMAVLSAGDPDPSRCLRSNPAEASDLLPPVAGGGDTITHQPDSCKAAPEHRSGITAFMKVLNSLQKKQMNTSLCERIRKVYGDLECEYC,VPLSSKSSLVNTATRSSSSSTRCRPTGSTPMKSHTSAPSAAMPVPSRPTSMCTCASTLERSSPATIARSPAARATSRCTSSECTRRSSSTAASARRSTLTSRTSSSTSETRMTHRTRRSKRPWTSSARGRASGSCSMTATSVSASSRTSWTVTAICWSTETSGLLPVSSVAMGPPSTRRWNCMSGSTPSCTSVPSAARSSSAPSGCAPTSKRCTGLPRRPWSSPVPSTRASASWNLVGTSSKKLWGTSYSWWKRSLPSRAMHSRKRPVLGTLSWRRAGRSRRPLGKCLPQLCTWPPRRPKAQPCHPVSWKPPWSPPQTCILKRWFQMIFCKMIPPPQRLMLLLRSPQTCSTEAQSRRKVKSHYCCPRPRVLGQIRKAMAPRAPGKGRTWLCFQLVTQIPAGVSGQTQLRPQTSSLQLVVGTPSHISLTLAKLPLSTGQASPLSRSTVYRRSKTPACVSGSGRFMETWSVNTV