McDonnell Genome Institute

Washington University

CircRNA

chr8|133011900|133030023|+|TG|ENST00000220616.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9546

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

AVLMCLWTR

Amino Acids from 5' Exons

CLWTRGSPWPSLQWLLIHPLGTLMLPMSALLPPAISLLSETSVCR,VSGLVAVPGPLFSGCSIHALCCPCQHCCHQQFLCCPRPLFV,SLDSWQSLALSSVVVDPSIRHFDVAHVSTAATSNFSAVRDLCLS

Amino Acids from 3' Exons

GPERVATGGCWTRWRLPGCRPTSEDLAGTLGACPWQQTVAGLMWPASTFSRPGPPTPNFSGELC,VRRGEWQLGAAGPGGGSDLGADPHPRIWRGPSARVPGSRPWRGCGQHPPSHGQGHQLPTFPESCAD,SGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLTARATNSQLFRRAVLM