McDonnell Genome Institute

Washington University

CircRNA

chr8|132868114|132882999|+|TG|ENST00000220616.8

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9457

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

KCMEPGSK

Amino Acids from 5' Exons

STRWMPSPFVPVSCRGKRPFSKQTTCPSVQRMAAS,VPGGCPAPSSLAAEGNGLSEASRLRAPVCRGWQLP,YQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSF

Amino Acids from 3' Exons

APQNVKWSGLQQPALVTPMFQAAAEMATIRRCSARRKGPAGVWTPRGRKCMEPGSKGSRHLV,PHKMSGAVYSNQLWSPLCSKLPPKWRLSGGAVPDGRALLVCGRPGEGNAWNPAARGAAIL,PTKCEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSC