McDonnell Genome Institute

Washington University

CircRNA

chr8|132777795|132817545|+|PHF20L1|ENST00000220847.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9294

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

GAPAAAVK

Amino Acids from 5' Exons

KENTEEDLKMSKKPPNRPGITFEIGARLEALDYLQK,EKRILKNRISRVKSPQIALESLLRLVLVWRHWTTYKN,KREYRIGSQDEKAPKSPWNHFDWCSFGGTGLLTKM

Amino Acids from 3' Exons

CLMLHICHLRSWDPVSLLTVVVQKLQHRPQIPLTVMNVPGQKKRIHRCFQILLPKQLMEEELQQQQ,ACCTFATEAGTLSPSLKSWFRSYSTGSLRFLLPMSQGRKRGYTDASKSFFQSNSWKRSSSSS,PDVAHLPLEKLGPCLPLDLSRGSEVTAPVASDSSYRNECPRAEKEDTQMLPNPSSKAIADGRGAPAAA