McDonnell Genome Institute

Washington University

CircRNA

chr8|132583693|132625454|-|LRRC6|ENST00000250173.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9132

94

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

6

Peptide

TTSDRSREQTNTSSSLESK

Amino Acids from 5' Exons

VGEVITGGQRAFKSMKTTSDRSREQTNT,EKSQVVSEHSNLKLPRTGAENKQIQ,RRSNHRWSASIQIYENYLGQEQRTNKYK

Amino Acids from 3' Exons

FLFREQRPPTGTRHRGTQHKEIRQQRLGILEALFVYSIKIGNSTHGKTTEETGKIK,SSLESKDHLQAPDTEEHNTKKLDNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKL,PLRAKTTYRHQTQRNTTQRNTTVKMTWNSGISPVCLLLNQDWKLLDTWKNNGRNRKN