McDonnell Genome Institute

Washington University

CircRNA

chr8|125003175|125018727|+|SQLE|ENST00000265896.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9738

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

LFMNYFLPQMRR

Amino Acids from 5' Exons

RRKGTNISETSLIGTAACTSTSSQNDPEVIIVGAGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLG,AEKEPIFQKQAEQLPVHQHLLRMTQKLSSWELACLALLWQLCFPEMEERQSLRETKSLTELENSCSRVVIMFSKTLVLE,QKRNQYFRNKLNRNSCLYINIFSEPRSYHRGSWRAWLCFGSCAFQRWKKGDSHERLKRAQNSWRIPAAGWLSCSQRPWSW

Amino Acids from 3' Exons

AKKSFYWARKTSHSFVVNILAQALYELFSATD,PKNHFTGQEKHLIPLSISLLRLFMNYFLPQM,QKIILLGKKNISFLCREYPCSGSLIIFCHR