top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|124562781|124591235|-|MTSS1|ENST00000325064.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9159

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

5

Peptide

SPSPMPPEAPNQVGPGR

Amino Acids from 5' Exons

QPEQCQQQLPVQRLPLAFPQLTLPLPQLQPGPAGSCEAVQRVLPLRIHIPGCLPVQVTIPHAARGPQP,SLNSVNSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQ,ATVSTAVTPGPAAPTRIPPAHITATAAPTWPSRLLGCPACPPMTQDSYPRMPSSPSHHPPCRQRPPT

Amino Acids from 3' Exons

VGPGRLDLLSPGCAGTEALKPSGSFR,WDQGDWICSHQDVHEAQKHSQAEAVFE,GTREIGSALTRMCMRHRSIEAKLRQFS

bottom of page