McDonnell Genome Institute

Washington University

CircRNA

chr8|120811272|120812069|-|SNTB1|ENST00000395601.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9921

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

EGAEAGAGR

Amino Acids from 5' Exons

VAPPRSGSGEGEPAVQLPTPAECVCELPERSPACRHLPAGRTLLAPPGPASSPRPPFPTFPPFSNHMAFECRKDGGSGGGGGGWAGWRGRRPGAAERAAGSFGAGSLAQSSGELERGRPGSEQRGGRCGVQRHRDRHQWLVLQGRRGWAPGRGRRAAPGLARRGPHRFHRPARAGARVHLEPEAWREGAEAGAGRAGDQHQGGQGEQDAHPHQQDLQGAGGGPDPSPVRGRRHPVRERSRPAGRHPRRGGAGVEARGQGSAAG,LLHPGQDQARGNQPECSCQLPPSASANSRSGVPRAATSPRDALSSLPRAPRPPPGHPSPLFPPFPITWHFKNAGKMAVAAAAAAAGPAGAGGGRAQRSGLLEVLVRDRWHKVLVNLSEDALVLSSEEGAAAYNGIGTATNGSFCRGAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALKRAGKEVLLE,CSTPVRIRRGGTSLSAAANSRRVRLRTPGAESRVPPPPRGTHSPRSPGPRVLPPATLPHFSPLFQSHGILRMPERWRRRRRRRLGRLAREAAGRSGAGCWKFWCGIAGTKFWTARTPWFAARRALRRTTASGPPPMARSAGAPGLGTRARAARSPRTRPPGSAPLSPTCPSRCPSPSRTRSVARCSRSWAGWGSASRGARRTRCPSSSARSSRGWRRTRPKPCTWATPSCPTEPTCGTPPTTRRCRRSARARKCCWK,VAPPRSGSGEGEPAVQLPTPAECVCELPERSPACRHLPAGRTLLAPPGPASSPRPPFPTFPPFSNHMAFECRKDGGSGGGGGGWAGWRGRRPGAAERAAGSFGAGSLAQSSGELERGRPGSEQRGGRCGVQRHRDRHQWLVLQGRRGWAPGRGRRAAPGLARRGPHRFHRPARAGARVHLEPEAWREGAEAGAGRAGDQHQGGQGEQDAHPHQQDLQGAGGGPDPSPVRGRRHPVRERSRPAGRHPRRGGAGVEARGQGSAAG,LLHPGQDQARGNQPECSCQLPPSASANSRSGVPRAATSPRDALSSLPRAPRPPPGHPSPLFPPFPITWHFKNAGKMAVAAAAAAAGPAGAGGGRAQRSGLLEVLVRDRWHKVLVNLSEDALVLSSEEGAAAYNGIGTATNGSFCRGAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALKRAGKEVLLE,CSTPVRIRRGGTSLSAAANSRRVRLRTPGAESRVPPPPRGTHSPRSPGPRVLPPATLPHFSPLFQSHGILRMPERWRRRRRRRLGRLAREAAGRSGAGCWKFWCGIAGTKFWTARTPWFAARRALRRTTASGPPPMARSAGAPGLGTRARAARSPRTRPPGSAPLSPTCPSRCPSPSRTRSVARCSRSWAGWGSASRGARRTRCPSSSARSSRGWRRTRPKPCTWATPSCPTEPTCGTPPTTRRCRRSARARKCCWK

Amino Acids from 3' Exons

VAPPRSGSGEGEPAVQLPTPAECVCELPERSPACRHLPAGRTLLAPPGPASSPRPPFPTFPPFSNHMAFECRKDGGSGGGGGGWAGWRGRRPGAAERAAGSFGAGSLAQSSGELERGRPGSEQRGGRCGVQRHRDRHQWLVLQGRRGWAPGRGRRAAPGLARRGPHRFHRPARAGARVHLEPEAWREGAEAGAGRAGDQHQGGQGEQDAHPHQQDLQGAGGGPDPSPVRGRRHPVRERSRPAGRHPRRGGAGVEARGQGSAAG,LLHPGQDQARGNQPECSCQLPPSASANSRSGVPRAATSPRDALSSLPRAPRPPPGHPSPLFPPFPITWHFKNAGKMAVAAAAAAAGPAGAGGGRAQRSGLLEVLVRDRWHKVLVNLSEDALVLSSEEGAAAYNGIGTATNGSFCRGAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALKRAGKEVLLE,CSTPVRIRRGGTSLSAAANSRRVRLRTPGAESRVPPPPRGTHSPRSPGPRVLPPATLPHFSPLFQSHGILRMPERWRRRRRRRLGRLAREAAGRSGAGCWKFWCGIAGTKFWTARTPWFAARRALRRTTASGPPPMARSAGAPGLGTRARAARSPRTRPPGSAPLSPTCPSRCPSPSRTRSVARCSRSWAGWGSASRGARRTRCPSSSARSSRGWRRTRPKPCTWATPSCPTEPTCGTPPTTRRCRRSARARKCCWK,VAPPRSGSGEGEPAVQLPTPAECVCELPERSPACRHLPAGRTLLAPPGPASSPRPPFPTFPPFSNHMAFECRKDGGSGGGGGGWAGWRGRRPGAAERAAGSFGAGSLAQSSGELERGRPGSEQRGGRCGVQRHRDRHQWLVLQGRRGWAPGRGRRAAPGLARRGPHRFHRPARAGARVHLEPEAWREGAEAGAGRAGDQHQGGQGEQDAHPHQQDLQGAGGGPDPSPVRGRRHPVRERSRPAGRHPRRGGAGVEARGQGSAAG,LLHPGQDQARGNQPECSCQLPPSASANSRSGVPRAATSPRDALSSLPRAPRPPPGHPSPLFPPFPITWHFKNAGKMAVAAAAAAAGPAGAGGGRAQRSGLLEVLVRDRWHKVLVNLSEDALVLSSEEGAAAYNGIGTATNGSFCRGAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALKRAGKEVLLE,CSTPVRIRRGGTSLSAAANSRRVRLRTPGAESRVPPPPRGTHSPRSPGPRVLPPATLPHFSPLFQSHGILRMPERWRRRRRRRLGRLAREAAGRSGAGCWKFWCGIAGTKFWTARTPWFAARRALRRTTASGPPPMARSAGAPGLGTRARAARSPRTRPPGSAPLSPTCPSRCPSPSRTRSVARCSRSWAGWGSASRGARRTRCPSSSARSSRGWRRTRPKPCTWATPSCPTEPTCGTPPTTRRCRRSARARKCCWK