McDonnell Genome Institute

Washington University

CircRNA

chr8|11845660|11853479|-|CTSB|ENST00000345125.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

121

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

27

5

Peptide

ILGWGVENGTPYWLVANSWNTDWGDNGGSRIR

Amino Acids from 5' Exons

ECTNTSPERWVAMPSASWAGEWRMAHPTGWLPTPGTLTGVTM,SVPTRHRRDDGWPCHPHPGLGSGEWHTLLAGCQLLEHLGQ,VYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDN

Amino Acids from 3' Exons

VDLGSGFQHVAALGLPLLPAGVGQCPEQALFPSPVGAGQLCQQTEYHVA,WIDPASNMWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQ,GSRIRLPTCGSSGPPSAACWCWPMPGAGPLSIPCRMSWSTMSTNGIPRG