McDonnell Genome Institute

Washington University

CircRNA

chr8|112666276|112690050|-|CSMD3|ENST00000297405.9

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9966

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LNLDTLSK

Amino Acids from 5' Exons

PHVVAIFQLPVEFSHQDGQDTTKTLIVSGLKLNLDTLSKLHLK,PMWWPFFSSQWSDSLTRMARILQRLFELVGDSTWTLYQNYIK,PCGGHFSAPSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFE

Amino Acids from 3' Exons

KLRKKVVVILVHPYMELEKAMDFLIVMFGLNASLGLNLERNPLFVKRITNGLQTYPSVS,NERKLWSWYTLIWNRRRWIFSCFKVMPVWVINWREIHCLSREPMVCKHTHLY,IEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPICI