McDonnell Genome Institute

Washington University

CircRNA

chr8|109464215|109477396|+|PKHD1L1|ENST00000378402.9

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9702

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

LMGHPMTETFVK

Amino Acids from 5' Exons

VFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYDIKGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAVAGGTHFGFWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGMWIFEEYFPMQTGSCTSTVPAPAIFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPYVGGWGETNGAVIKNAKIVGHLDELGMGSAFCTAKGLVLPFSEGLTVSSVHFMNFDRPNCVALGVTSISGVCNDRCGGWSAKFVDVQYSHTPNKAGFRWEHEMVMIDVDGSLT,YSMLARLSGWGDIQYIGTCLETYSLNLMEAVQFTRPITELLLFITHTIFWLRGILYMILREEHFLKMVLNMAISSSITWQYLYSKVPVFMMMPRLHFGSPTRTIPYDTMLLLVALTLAFGTGTTTLMGHPMTETFVKKEFPLANFLTILSILKVGLECGSLRNISPCKRDLVHLQCLHLQYLTHLLLGIVKKELNGSMEVPFSSITLWITMRLELRLRGSWLLMLEGGVKPMERLKMPKSAILMNWEWGLHFAQQKAWFSHLVKALSLLCTLTLTVPTVLWEHPSLEFVMTDVGVGVQSLLTSSILTHRTRLAFAGNMKWLMLMAHLQ,IPCWPGFPVGAISNTLAPAWRLTVILCKRLCNSPGLQSCYYSHTPSSGEEYYIYGRSIFYRRWYTWQYPPVLGSICTAKYQSSECDPGCILGHQPEQYHTTQCCCWWHSLWLLVPDEQPPWAILQKHLSKKSSPWRIFQYCPFSRLVWNVDLGIFPHANGILYIYSACTCNILTYYLELSKRSMGQWRCPSVPLCDGELGWNDEDPGSLCWRVGNQWSGDKCQNSRPSTGNGVCILHSKRPGSPIRLDCLFCALYELPSQLCSFGSDIHLWSLQMWGLECKVCRPVFSHTEQGWLSLGTNGNDCWLTY

Amino Acids from 3' Exons

CQEEMTFIRVSSFLGTWILMKTLLLISKLTVVFSRIAFLYIRHQENQFPRSDQPHI,VRKKPSSESAHFWEPGSCERRCYFPSLLLYSPGLLSCTSAIKKTNSQEATSHI,SGRNDLHQSQLISGNLDPDVKDVVINFQAYCCILQDCFPVHPPSRKPIPKKRPATY