McDonnell Genome Institute

Washington University

CircRNA

chr8|104244915|104251163|+|RIMS2|ENST00000262231.14

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

52

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

SFTEAGGK

Amino Acids from 5' Exons

KQEVKNGALSKEVQKQAWPWKGTGLDRQAESLQMVATATAQKE,SRRKTKEHCPKKYRNRPGRGNEELDDSTGKPRVYRWHEQLQLRRK,AGGKKLRSTVQRSTETGLAVEMRNWMTRQASRESTDGSMNSYSSEG

Amino Acids from 3' Exons

HRMKCIYITESAPKRKQKWQEKRWNPFTSSYYLSKRVHKEKFY,TVCKSVSIRRSLHSQKENKSGKKNAGTPLPAAIIFRRESTRKSFT,PYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFEESPQGKVLQ