McDonnell Genome Institute

Washington University

CircRNA

chr8|100924915|100948900|-|YWHAZ|ENST00000353245.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9451

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

KEHPVMDK

Amino Acids from 5' Exons

SLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKK,LFWKSSSPMLHKQRAKSSIKKEITTVTWLRLPLVMTRK,SFGKVLDPQCFTSREQSLLFENERRLLPLLGGCRWQE

Amino Acids from 3' Exons

NIQSWIKMSWFRRPNWPSRLSDMMTWQPASLLSKELNYPMRRGIFSQLLIKMLEPVGHLGGSSQVLNKRRKVLRKNSRWLENTERKLRRSEISAMMY,TSSHGKAGSEGQTGRAGAIHGSLHEVCNARSIIQGEESSLSCLKCCRSPVILEGRLKYTKDGRCEKTADGSRIQRENDGAKRYLQCT,HPVMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVL