McDonnell Genome Institute

Washington University

CircRNA

chr7|99836452|99848254|+|CYP3A43|ENST00000481362.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.949

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

GQGAVFSIYVLEDMVSHYK

Amino Acids from 5' Exons

LWDPFTTFEAGNSWANPSAFSGNYFVLP,YGTHSHKLFKKLGIPGPTPLPFLGTILFYLR,MGPIHINFLRSWEFLGQPLCLFWELFCSTL

Amino Acids from 3' Exons

PLGPMGFLKSALSFAEDEEWKRIRTLLSPAFTSVKFKEVRKGDLLETRMNLETGSKYHHSSFLMGSPLSLSFLKRVFSAGHSGSCLSQHFGRPRWVDHLRLGDDQPGQHGETPTLLKIQKLAGHGGGCLSLLRRLRQKNCLNLEAEVAMSQDCAVALQPGQQERNSVSKKRGRGRSFLFMSRTWVITKYHLLFHAGQSHVLLRLESALTMGGVVFMVPIISQCGDMLVRSLRQEAENSKSINLK,LVQWDFKVPVLLKMKNGREYEHCYLQLSPVNSRKENKVIYNKLKGIWRQVVSIIIVPFWVVHVAFKGSFQLGTVAHACNPSTLGGRGGWITGEIETSLANMVKPQLYKYKNLGMVADAYNPSCSEGGRRIVIRRRLQAKIAPLHSSLGNKSETLSQKKGAGGGLFYLCPRGHGESLQNIIYCSMLGKAMSFDSSLRSLWVVLCFRWSPSFPNVEICWEAGRKQRTASPSTK,FRSNGISEKCLKFCRRMEENTNIAISSFHQCKIQGSKKIRFIIRNLKDESGDRVSSFLSNGSTEFELSKKGLFSWAQWLMPVIPALWEAEVGGSPEVRRLRPAWPTWNPNSTKNTKISWAWWRMPIILAAQKAKAEELFESRGGGCNEPRLRRCTPAWATRAKLCLKKKGQGAVFSIYVLEDMVSHYKISFTVPCWAKPCPSETRVCVVNYGWCCVLDGPHHFPMWRYVGEKPEAGSREQQVHQLER