McDonnell Genome Institute

Washington University

CircRNA

chr7|99429102|99429806|-|PTCD1|ENST00000292478.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9384

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

22

Peptide

VPLEGLSSTERPEAPAAAAGQK

Amino Acids from 5' Exons

EIIHKGHVVTEETFSFLLMGCIQDKKTGFRYALQ,KSSTKGTWSQRRPSVSCSWAASKTRRQASGTPS,NHPQRARGHRGDLQFPAHGLHPRQEDRLPVRPP

Amino Acids from 3' Exons

MKKRDLEPSDATYTALFNVCAESPWKDSALQSALKLRQQLQAKNFELNLKTYHALLKMAAKCADLRMCLDVFK,KSGTWSPRTPPTRPCSTSVPSPPGRTQLYRAPSSGSSCRPKTSSSTKHTTRCRWLPSAQTLGCASMCS,EKAGPGALGRHLHGPVQRLCRVPLEGLSSTERPEAPAAAAGQKLRAQLENIPRAAEDGCQVRRPDVPRCVQ