top of page

McDonnell Genome Institute

Washington University

CircRNA

chr7|95225960|95284216|+|PPP1R9A|ENST00000289495.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

NLPAPTSSLQPSPETLISDK

Amino Acids from 5' Exons

TGEYATDEEEDEVGPVLPGSDMAIEVFELPENEDMFSPSELDTSKLSHKFKE,QENMPQMKKKMRDLSFLAATWPLKSLSCLRMRTCFPHQNWTQASSVTSSK,RRICHRRRRGRTCPSWQRHGHSLAAEGHVFPIRTGHKQAQSQVQR

Amino Acids from 3' Exons

DLQRQTGKLDTQAMFNSSDLHSFPLHAFLMVQPERILFLQEPACAYKFPSAFSDSNFRKGVQ,IFRGRLENWTPKPCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSK,SSEADWKTGHPSHVQQLRPPLVPLACLSHGLMTAGKDPIPSGTCLRLQVPFSLLLRLFQIKRGP

bottom of page