McDonnell Genome Institute

Washington University

CircRNA

chr7|93239865|93291835|+|CCDC132|ENST00000305866.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9308

31

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

ILLQLLGLK

Amino Acids from 5' Exons

GLKSPQESLSDLGAIESLRVPGK,VKALKKASVILVPRVSGSLE,SEKPSRKPQSWCHRESPGPWK

Amino Acids from 3' Exons

HVTPDSYIPCLADLCKALWEVMLSYYRTMEWHEKHDNEDTASAS,MLHQTAIFHALQTCAKHYGKLCSAIIGLWNGMKSMTMRILLQLL,CYTRQLYSMPCRPVQSTMGSYAQLLDYGMAKAQGYCFSF