McDonnell Genome Institute

Washington University

CircRNA

chr7|92517275|92518255|-|PEX1|ENST00000248633.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9594

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

16

Peptide

VWELHAVSLEQHLLDQIR

Amino Acids from 5' Exons

LHYQLPLMEGWKLTPNSLFSQRHAEPKRIHFQKLMLNIKNFIVMEETRKEKNFKPSNFSQILWESLNLMKTSQRFQLTHHQQVYGLEAFFPFNLRRNKRHLGVLKSMHSKICSQRLFLTIFSEYANLNLLVYITRQQPLFFINTVPFMYFHGTRNILMSPALLHMESLSYFLQSNSKVKQNKMCYHLKKRSRCQSHIKKKLGQIIMKKMRRPVCYKSGMDLKNTMPSNIPKMKFSILGKS,CTNTSCLLWKAGNHQTPYSAKDTPSQREYIFKSCIKTSLWKRPERNDERTSNQATSVKYCGNHIKRVRDSSLIISSKFMDYDRKHFFLSIEETRDILGFNNQCIQKYAVKGCSSRQYFQSMQISTSYIRVSNLCFSTLCHSCISMGPGIFCRAQLYCDIWKASATFSKATAKNKTKCVITKREADVRATRSKKNVRSRREGLCATSSLEWTRIEQCHQIYQKCRSSPSWESL,ALIPAASYGRLETDTKLLIQPKTRRAKENTFSKADAEYKKLHSYGRDQKGMMKELQTKQLQSNTVGITESNENESEIPVDSSSVASLWTMIGSIFSFQSEKKQETSWGLTEINAFKNMQSKVVPLDNIFRVCKSQPPSIYNASATSVFHKHCAIHVFPWDQEYFDVEPSFTVTYGKLVKLLSPKQQQSKTKQNVLSPEKEKQMSEPLDQKKIRSDHNEEDEKACVLQVVWNGLEELNNAIKYTKNVEVLHLGKVW

Amino Acids from 3' Exons

ELHAVSLEQHLLDQIRIVFPKAIFPVWVDQQTYIFIQI,SCMLFPLNNIFIKFEFFQKPFFLFGLINKRTYLSKL,AACCFPTTSSRSNSNSFSKSHFSCLGSTNVHIYPN