McDonnell Genome Institute

Washington University

CircRNA

chr7|92386508|92391344|+|ANKIB1|ENST00000265742.7

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9299

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

NIVRPLEVITDVLAMK

Amino Acids from 5' Exons

CKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVE,ASMTFAGFALKSGKNIVRPLEVITDVLAMKSFNTWRSNPRKLW,QVLLLDLPRVEKTFVHWRLLQMYSLSHSTRGGAIQGNDCG

Amino Acids from 3' Exons

TDLEMVTEDLAQKVNRPYLRTPRHKIIKAACLVQQKRQEFLASVARGVAPADSPEAPRR,QTKWSLKTLPRKSIGLTFAHPATRSSKQHALYSRRGKNSWHLWLGELLQTHQKLQGA,RPRNGHRPCPESQALPSHTPPQDHQSSMPCTAEEARIPGICGSGSSSCRLTRSSKAQ