McDonnell Genome Institute

Washington University

CircRNA

chr7|92012428|92029991|+|AKAP9|ENST00000356239.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9379

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

NIDGTIENDLR

Amino Acids from 5' Exons

NDLRLQMEAQRICLSLVYSTHVDQVREYMENEKDKALCSLKEELIFAQEEKIKELQKIHQLELQTMKTQET,MIGYRWKPNAFASLWFIQLMWIRFVNIWKMKKIKLFAVLKKSLFLLKRKRSRNFRKYTSNYRLKHKKQ,FKATDGSPTHLPLSGLFNSCGSGSIYGKKRSSLQSRRAYFCSRGKDQGTSENTPVRTTDYENTRN

Amino Acids from 3' Exons

LTCFGGNYRICTENNVPWKLCEKEYWYNR,LPVDSVVITESDAQRTMYPGSCVKKNIDGTIE,YLLIRWLQNLMHREQCTLEVVKRILMVQ