McDonnell Genome Institute

Washington University

CircRNA

chr7|91992884|92023009|+|AKAP9|ENST00000356239.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9791

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

KNLVLMILILNK

Amino Acids from 5' Exons

EEEFGVDDSYSEQGAQDSPTHLEMMESELAGKQHEIEELNRELEEMRVTYGTEGLQQ,KKNLVLMILILNKEHKTVRLIRWKVSWLGSSMRLKSTESWKKGLPMGLKDCS,RRIWCFLFTRSTRQSDSSRDDGKVGWEAADRAKQRAGRNEGYLWDRTAA

Amino Acids from 3' Exons

MSIIKASYLLCKILKKLNLKNKFKNKASYPLCSNSKKLNKTMRQRSTVYRRGFKLLVSPRFRQ,CQSKQVIFSARSKNTRTSSRIRKPHILFAATVERNTKLGRDPLFTEEASSCVHGSAK,VNHKSKLSSLQDLEKTKLEEQVQELESLISSLQQQLKETEQNYEAEIHCLQKRLQAVSESTVPP