McDonnell Genome Institute

Washington University

CircRNA

chr7|91973710|92052958|+|AKAP9|ENST00000356239.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9452

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

11

Peptide

LLEAISETSSQLAQFR

Amino Acids from 5' Exons

LAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVSAHHDLNIDQSQCNEMYINSSQRVESTVIPESTIMRTLHSGEITSHEQGFSVE,LPSFDKEKLSRMGRVLPRSRKKREKRQAVNMMCQHTMIILINHSVMKCTIVLRENQLFLNLQELYIVEKPVMSRASLW,CPVSTKKSSVGWAESFQEAEKKEKNVKQTCVSTPFEYSITVNVHKFSESRINCDSIYNNENSTWRNNQSAGLLCG

Amino Acids from 3' Exons

LQMNPFPLILEVICQEMTLTCGQKLRKEQSCHNDLGVVLLELKTLKMKNLCTLALDYKQQLKNSKPVKLAV,YRIHSLLFWKYAKKHHVVKSNGRNRAVTTTCEEWFCWNNRPKRTYAEHLSTTSSSKTPRSHKNQS,TDESIPSYSGSDMPRNDINMWSKVTEEGTELSQRLVRSGFAGTEIDPENEELMLNISSRLQAAVEKLLEAISETSSQ