McDonnell Genome Institute

Washington University

CircRNA

chr7|90352815|90372228|+|GTPBP10|ENST00000222511.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9076

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

QNLQLQITHYGNFIDK

Amino Acids from 5' Exons

YGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANS,MEISSISDSSPGEDPVEWVILVVEKVEKVVMSGLPRTELNNLKTGILGNGLWLEEQTA,WKFHRAKTLHQGRIRWNGLSSFRWRRWKRWCLGCSPEQNDFKTTRQVSSETVCGWSRSKQQ

Amino Acids from 3' Exons

IPKCWKILFAKLCFSCKTCNCRLR,FPNAGKSSLLSCVSHAKPAIADYA,SQMLENPLCVVFLMQNLQLQITH