McDonnell Genome Institute

Washington University

CircRNA

chr7|85121740|85153739|-|SEMA3D|ENST00000444867.1

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9937

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

TVTSAVLVAR

Amino Acids from 5' Exons

IKLTPFEREHCFHHECRKTSQKPRFSPFSCFDDAKHDHVVSSSHWHFEAKYSKTQANLQ,LNHHLKENIVFIMNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTLKQNIPRLKLTYK,INTIKRTLFSSMLIKMKDLKPEAKIFTFFLLCAPCCFFQSLALSKIFQDSSPTK

Amino Acids from 3' Exons

VFTLGLELHLLSWLPGFTYTVGSPGSSPYQLQILGLISLNNY,SLHLDNCNICCPGCQAFEHTLLVLLDLHLTNCRSWDSSASII,LYTWTRTVTSAVLVARLLNIHCWFSWIFTLPTADLGTHQPQL