McDonnell Genome Institute

Washington University

CircRNA

chr7|841945|848615|+|SUN1|ENST00000340926.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LSYESENYK

Amino Acids from 5' Exons

NNKTAQKHKQISFYQPRVKAGHVLWRQPRRHCQPAGCCDSTASCIGRVLDSTDHSGPLL,TTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFW,QQNSAEAQTNQLLVSTTCQGRSRPLASATAALSACRMLLDGLLYWTSLGFVNRPQWTTSG

Amino Acids from 3' Exons

AVRLSTIGFCGWPDTLHHLFHHFFNFFKWFSSVMNQKITNKLMNQKIVNPKAISQKAMNQK,RCVFLREDFVAGQIHCIIFFIIFSSTFSSGFNEAQLIRKLQIENSIKRLIRKLVKKPIK,GASFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKSHESK